Anti-Mouse SIRP Alpha/CD172a Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse bone marrow cells using 98225-1-RR (same clone as 98225-1-PBS)

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse SIRP alpha/CD172a Rabbit Recombinant Antibody (98225-1-RR, Clone: 241794D9) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Mouse CD11b. Cells were not fixed. This data was developed using the same antibody clone with 98225-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse bone marrow cells using 98225-1-RR (same clone as 98225-1-PBS)

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse SIRP alpha/CD172a Rabbit Recombinant Antibody (98225-1-RR, Clone: 241794D9) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98225-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98225-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98225-1-RR against Mouse SIRP Alpha/CD172a were performed. The affinity constant is below 1 pM.

SIRP Alpha/CD172a Uni-rAb^® Recombinant Antibody for FC

Cat No. 98225-1-PBS

Clone No.241794D9

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

241794D9, Bit, Brain Ig-like molecule with tyrosine-based activation motifs, CD172 antigen-like family member A, CD172a

---

Product Information

98225-1-PBS targets SIRP Alpha/CD172a in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1520

  Product name: Recombinant Mouse SIRP alpha/CD172a protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 32-373 aa of NM_007547.4

  Sequence: KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWN

• Full Name: signal-regulatory protein alpha
• Calculated Molecular Weight: 56 kDa
• GenBank Accession Number: NM_007547.4
• Gene Symbol: Sirpa
• Gene ID (NCBI): 19261
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P97797-2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SIRP Alpha, also known as CD172a, SHPS-1, and BIT, belongs to the SIRP family. SIRP Alpha is a transmembrane glycoprotein expressed explicitly on myeloid cells and provides a "do not eat me" signal after engaging with integrin-associated protein CD47 on tumor cells (PMID: 36419386). SIRP Alpha shows heterogeneity in molecular weight (~65-120 kDa) in various tissues due to differential glycosylation (PMID: 18051954).