SIRP beta 1/CD172b Monoclonal antibody, PBS Only

• 

  WB analysis using 68206-1-Ig (same clone as 68206-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68206-1-Ig (SIRP Beta 1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68206-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 68206-1-Ig (same clone as 68206-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68206-1-Ig (SIRP Beta 1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68206-1-PBS in a different storage buffer formulation.

• 

  IF Staining of OS-RC-2 using 68206-1-Ig (same clone as 68206-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed OS-RC-2 cells using SIRP Beta 1 antibody (68206-1-Ig, Clone: 3A3H1 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 68206-1-PBS in a different storage buffer formulation.

SIRP beta 1/CD172b Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 68206-1-PBS

Clone No.3A3H1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

SIRPB1, SIRP Beta 1, SIRP-beta-1, Signal-regulatory protein beta-1, CD172b

---

Product Information

68206-1-PBS targets SIRP beta 1/CD172b in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28615

  Product name: Recombinant human SIRPB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-181 aa of BC025286

  Sequence: MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVREPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA

• Full Name: signal-regulatory protein beta 1
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC025286
• Gene Symbol: SIRPB1
• Gene ID (NCBI): 10326
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00241
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SIRP Beta 1 is a member of the signal-regulatory-protein (SIRP) family and also belongs to the immunoglobulin superfamily. SIRP family members are cell surface signaling receptors differentially expressed in leukocytes and the central nervous system. SIRP Beta 1 interacts with TYROBP/DAP12, a protein-bearing immunoreceptor tyrosine-based activation motif. SIRP Beta 1 also participates in the recruitment of tyrosine kinase SYK.