Mouse SIRP Alpha/CD172a Recombinant monoclonal antibody, PBS Only (Detector)

SIRP Alpha/CD172a Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84430-2-PBS
Clone No.241794D9

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

241794D9, Bit, Brain Ig-like molecule with tyrosine-based activation motifs, CD172 antigen-like family member A, CD172a

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84430-2-PBS targets SIRP Alpha/CD172a as part of a matched antibody pair:

MP01311-4: 84430-3-PBS capture and 84430-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1520

Product name: Recombinant Mouse SIRP alpha/CD172a protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 32-373 aa of NM_007547.4

Sequence: KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWN

Predict reactive species
Full Name signal-regulatory protein alpha
Calculated Molecular Weight56 kDa
Observed Molecular Weight90-140 kDa
GenBank Accession NumberNM_007547.4
Gene Symbol Sirpa
Gene ID (NCBI) 19261
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP97797-2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SIRP Alpha, also known as CD172a, SHPS-1, and BIT, belongs to the SIRP family. SIRP Alpha is a transmembrane glycoprotein expressed explicitly on myeloid cells and provides a "do not eat me" signal after engaging with integrin-associated protein CD47 on tumor cells (PMID: 36419386). SIRP Alpha shows heterogeneity in molecular weight (~65-120 kDa) in various tissues due to differential glycosylation (PMID: 18051954).

Loading...
||
New chat Able
正在加载,请稍候...