• Featured Product
  • KD/KO Validated

SKAP2 Polyclonal antibody

SKAP2 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA
Cat No. 12926-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

PRAP, Pyk2/RAFTK associated protein, Pyk2/RAFTK-associated protein, RA70, Retinoic acid-induced protein 70

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHL-60 cells, NIH/3T3 cells
Positive IP detected inmouse liver tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12926-1-AP targets SKAP2 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3615

Product name: Recombinant human SKAP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-359 aa of BC036044

Sequence: MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI

Predict reactive species
Full Name src kinase associated phosphoprotein 2
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC036044
Gene Symbol SKAP2
Gene ID (NCBI) 8935
RRIDAB_2189317
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75563
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SKAP2 (src kinase associated phosphoprotein 2), also named PRAP, contains PH domain and SH3 domain. It is localized in cytoplasm and was expressed in ubiquitously in various tissues including lung, skeletal muscle, and spleen, but not detectable in thymus and T cell lymphoma cells. SKAP2 may negatively regulate alpha-synuclein phosphorylation following cell stress. SKAP2 may be involved in B-cell and macrophage adhesion processes by coupling the B-cell receptor (BCR) to integrin activation. Observed MW of SKAP2 is 55 kDa(PMID: 23161539).

Protocols

Product Specific Protocols
FC protocol for SKAP2 antibody 12926-1-APDownload protocol
IHC protocol for SKAP2 antibody 12926-1-APDownload protocol
IP protocol for SKAP2 antibody 12926-1-APDownload protocol
WB protocol for SKAP2 antibody 12926-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell Host Microbe

Identifying Yersinia YopH-targeted signal transduction pathways that impair neutrophil responses during in vivo murine infection.

Authors - Hortensia G Rolán
mouse,humanWB,IF

J Exp Med

Skap2 is required for β2 integrin-mediated neutrophil recruitment and functions.

Authors - Mark Boras
  • KO Validated
humanWB

Cancer Res

SKAP2 Promotes Podosome Formation to Facilitate Tumor-Associated Macrophage Infiltration and Metastatic Progression.

Authors - Masamitsu Tanaka
rat,humanWB

Diabetes

SKAP2, a Candidate Gene for Type 1 Diabetes, Regulates β-Cell Apoptosis and Glycemic Control in Newly Diagnosed Patients.

Authors - Tina Fløyel
  • KD Validated
mouse

Elife

SKAP2 is required for defense against K. pneumoniae infection and neutrophil respiratory burst.

Authors - Giang T Nguyen
mouseIF

Glia

SKAP2 as a new regulator of oligodendroglial migration and myelin sheath formation.

Authors - Julia Ghelman
Loading...
||
New chat Able
正在加载,请稍候...