Tested Applications
| Positive WB detected in | HL-60 cells, NIH/3T3 cells |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12926-1-AP targets SKAP2 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3615 Product name: Recombinant human SKAP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-359 aa of BC036044 Sequence: MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI Predict reactive species |
| Full Name | src kinase associated phosphoprotein 2 |
| Calculated Molecular Weight | 41 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC036044 |
| Gene Symbol | SKAP2 |
| Gene ID (NCBI) | 8935 |
| RRID | AB_2189317 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75563 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SKAP2 (src kinase associated phosphoprotein 2), also named PRAP, contains PH domain and SH3 domain. It is localized in cytoplasm and was expressed in ubiquitously in various tissues including lung, skeletal muscle, and spleen, but not detectable in thymus and T cell lymphoma cells. SKAP2 may negatively regulate alpha-synuclein phosphorylation following cell stress. SKAP2 may be involved in B-cell and macrophage adhesion processes by coupling the B-cell receptor (BCR) to integrin activation. Observed MW of SKAP2 is 55 kDa(PMID: 23161539).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SKAP2 antibody 12926-1-AP | Download protocol |
| IHC protocol for SKAP2 antibody 12926-1-AP | Download protocol |
| IP protocol for SKAP2 antibody 12926-1-AP | Download protocol |
| WB protocol for SKAP2 antibody 12926-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SKAP2 antibody (Cat# 12926-1-AP) has 21 citations across journals including Science, Cell Host & Microbe, Diabetes Care, Cancer Research, J Exp Med, Diabetes, Glia, J Biol Chem, iScience, Cell Cycle, J Cell Sci, Carcinogenesis, Frontiers in Oncology, Frontiers in Cardiovascular Medicine, Reproductive Sciences, Tumour Biology, Anticancer Research, BMC Research Notes, and eLife. Research fields span oocyte biology, innate immunity, diabetes, cancer metastasis, actin cytoskeleton dynamics, myelination, and cardiovascular disease.
| Species | Application | Title |
|---|---|---|
Cell Host Microbe Identifying Yersinia YopH-targeted signal transduction pathways that impair neutrophil responses during in vivo murine infection. | ||
Cancer Res SKAP2 Promotes Podosome Formation to Facilitate Tumor-Associated Macrophage Infiltration and Metastatic Progression. | ||
Diabetes Care Diabetes With Multiple Autoimmune and Inflammatory Conditions Linked to an Activating SKAP2 Mutation | ||
J Exp Med Skap2 is required for β2 integrin-mediated neutrophil recruitment and functions.
| ||
Diabetes SKAP2, a Candidate Gene for Type 1 Diabetes, Regulates β-Cell Apoptosis and Glycemic Control in Newly Diagnosed Patients.
|
