SKP1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67745-1-Ig (same clone as 67745-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67745-1-Ig (SKP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67745-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 67745-1-Ig (same clone as 67745-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using SKP1 antibody (67745-1-Ig, Clone: 1D5G4 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67745-1-PBS in a different storage buffer formulation.

SKP1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67745-1-PBS

Clone No.1D5G4

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EMC19, OCP 2, OCP II, OCP2, Organ of Corti protein 2, Organ of Corti protein II, p19A, p19skp1, SIII, SKP1, SKP1A, TCEB1L

---

Product Information

67745-1-PBS targets SKP1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30709

  Product name: Recombinant human SKP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-163 aa of BC009839

  Sequence: MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

• Full Name: S-phase kinase-associated protein 1
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC009839
• Gene Symbol: SKP1
• Gene ID (NCBI): 6500
• RRID: AB_2918514
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P63208
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SKP1(S-phase kinase-associated protein 1) is also named as EMC19, OCP2, SKP1A, TCEB1L,belongs to the SKP1 family.It is an essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription.