SKP1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• SKP1 Monoclonal antibody (67745-1-Ig)

SKP1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67745-1-Ig

Clone No.1D5G4

Publications(2)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1D5G4, Cyclin-A/CDK2-associated protein p19, EMC19, NET19, OCP 2

• 

  WB analysis using 67745-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67745-1-Ig (SKP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat cerebellum using 67745-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 67745-1-Ig (SKP1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 67745-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 67745-1-Ig (SKP1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 67745-1-Ig

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 67745-1-Ig (SKP1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 67745-1-Ig

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 67745-1-Ig (SKP1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse adrenal gland using 67745-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse adrenal gland tissue slide using 67745-1-Ig (SKP1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 67745-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67745-1-Ig (SKP1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 67745-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 67745-1-Ig (SKP1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 67745-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using SKP1 antibody (67745-1-Ig, Clone: 1D5G4 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells
• Positive IHC detected in: human thyroid cancer tissue, mouse adrenal gland tissue, mouse cerebellum tissue, mouse kidney tissue, rat cerebellum tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67745-1-Ig targets SKP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30709

  Product name: Recombinant human SKP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-163 aa of BC009839

  Sequence: MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

• Full Name: S-phase kinase-associated protein 1
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC009839
• Gene Symbol: SKP1
• Gene ID (NCBI): 6500
• RRID: AB_2918514
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P63208
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SKP1(S-phase kinase-associated protein 1) is also named as EMC19, OCP2, SKP1A, TCEB1L,belongs to the SKP1 family.It is an essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Acta Pharm Sin B; High glucose induces hippocampal neuron impairment through the SKP1/COX7C pathway: A potential mechanism for perimenopausal depression.; Authors - Ziqi Wang ; KD Validated
mouse	IF	Inflammation; Isoorientin Ameliorates Macrophage Pyroptosis and Atherogenesis by Reducing KDM4A Levels and Promoting SKP1-Cullin1-F-box E3 Ligase-mediated NLRP3 Ubiquitination; Authors - Xiaoshan Wang