SLAIN2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLAIN2 Polyclonal antibody, PBS Only (13908-1-PBS)

• 

  WB analysis of mouse brain using 13908-1-AP (same clone as 13908-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13908-1-AP (SLAIN2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13908-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Transfected HEK-293 using 13908-1-AP (same clone as 13908-1-PBS)

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 13908-1-AP (SLAIN2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13908-1-PBS in a different storage buffer formulation.

SLAIN2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13908-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

KIAA1458, SLAIN motif family, member 2, SLAIN motif-containing protein 2

---

Product Information

13908-1-PBS targets SLAIN2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4888

  Product name: Recombinant human SLAIN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 231-581 aa of BC040993

  Sequence: PGNSGNLKSSDRNPPLSPQSSIDSELSASELDEDSIGSNYKLNDVTDVQILARMQEESLRQEYAATTSRRSSGSSCNSTRRGTFSDQELDAQSLDDEDDNMHHAVYPAVNRFSPSPRNSPRPSPKQSPRNSPRSRSPARGIEYSRVSPQPMISRLQQPRLSLQGHPTDLQTSNVKNEEKLRRSLPNLSRTSNTQVDSVKSSRSDSNFQVPNGGIPRMQPQASAIPSPGKFRSPAAPSPLALRQPVKAFSNHGSGSPGSQEITQLTQTTSSPGPPMVQSTVSANPPSNINSATLTRPAGTTAMRSGLPRPSAPSAGGIPVPRSKLAQPVRRSLPAPKTYGSMKDDSWKDGCY

• Full Name: SLAIN motif family, member 2
• Calculated Molecular Weight: 581 aa, 63 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC040993
• Gene Symbol: SLAIN2
• Gene ID (NCBI): 57606
• RRID: AB_2877987
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P270
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLAIN2 (SLAIN Motif Family Member 2), also known as KIAA1458, is a microtubule plus-end tracking protein (+TIP) that forms a complex with end-binding proteins (EBs), cytoplasmic linker proteins (CLIPs), and ch-TOG. SLAIN2 binds to the plus end of microtubules and regulates microtubule growth and organization. SLAIN2 consists of 581 amino acids and has a calculated molecular weight of approximately 63 kDa.