Mouse SLAMF6 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86422-1-RR (same clone as 86422-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86422-1-RR (SLAMF6/CD352 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86422-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A20 using 86422-1-RR (same clone as 86422-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A20 cells using SLAMF6 antibody (86422-1-RR, Clone: 251099E10 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86422-1-PBS in a different storage buffer formulation.

SLAMF6 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86422-1-PBS

Clone No.251099E10

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

CD352, Ly108, Lymphocyte antigen 108, SLAM family member 6

---

Product Information

86422-1-PBS targets SLAMF6 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5249

  Product name: recombinant mouse SLAMF6/CD352 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 31-239 aa of NM_030710.2

  Sequence: EVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTNPPWN

• Full Name: SLAM family member 6
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_030710.2
• Gene Symbol: Slamf6
• Gene ID (NCBI): 30925
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9ET39-2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Signaling lymphocyte activation molecule 6 (SLAMF6) (Ly108 in mice, NTB-A or SF2000 in humans) is a homophilic receptor belonging to the superfamily immunoglobulin (Ig) domain-containing molecules (PMID:31199820). SLAMF6 is a type I transmembrane protein with two extracellular immunoglobins (Ig)-like domains and three cytoplasmic tyrosine-based signaling motifs, one of which is immunoreceptor tyrosine-based switch motif (PMID:31315913). SLAMF6 is expressed on a wide variety of immune cells including T cells (also TFH), B cells, NK cells (expressed in humans only), double positive thymocytes, eosinophils, and neutrophils (mouse only) (PMID:11862385).