Product Information
31329-1-PBS targets SLC10A4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34358 Product name: Recombinant human SLC10A4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 313-437 aa of BC019066 Sequence: ASGYGLATLFHLPPNCKRTVCLETGSQNVQLCTAILKLAFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYGTVKAENIIMMETAQTSL Predict reactive species |
| Full Name | solute carrier family 10 (sodium/bile acid cotransporter family), member 4 |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | BC019066 |
| Gene Symbol | SLC10A4 |
| Gene ID (NCBI) | 201780 |
| RRID | AB_3669945 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q96EP9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC10A4 belongs to the solute carrier superfamily and is a protease-activated transporter involved in uptake of bile acid (PMID: 23589386). SLC10A4 is expressed with a high expression in brain and is a vesicular monoaminergic and cholinergic-associated transporter that is important for dopamine homeostasis and neuromodulation (PMID: 25176177).
