SLC10A5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC10A5 Polyclonal antibody, PBS Only (25597-1-PBS)

• 

  IHC staining of mouse heart using 25597-1-AP (same clone as 25597-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25597-1-AP (SLC10A5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25597-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 25597-1-AP (same clone as 25597-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25597-1-AP (SLC10A5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25597-1-PBS in a different storage buffer formulation.

SLC10A5 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 25597-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

P5

---

Product Information

25597-1-PBS targets SLC10A5 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22339

  Product name: Recombinant human SLC10A5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-141 aa of BC136625

  Sequence: ARMSSLSFLNIEKTEILFFTKTEETILVSSSYENKRPNSSHLFVKIEDPKILQMVNVAKKISSDATNFTINLVTDEEGETNVTIQLWDSEGRQERLIEEIKNVKVKVLKQKDSLLQAPMHIDR

• Full Name: solute carrier family 10 (sodium/bile acid cotransporter family), member 5
• Calculated Molecular Weight: 438 aa, 49 kDa
• GenBank Accession Number: BC136625
• Gene Symbol: SLC10A5
• Gene ID (NCBI): 347051
• RRID: AB_3742153
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5PT55
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Solute Carrier Family 10 Member 5 (SLC10A5) is a member of SLC10, comprising transporters of bile acids, steroidal hormones, and other substrates. SLC10A5 is involved in the uptake of bile acid, and its deficiency causes hypercholanemia(PMID: 38986003).