SLC12A1/NKCC2 Polyclonal antibody

• 

  WB analysis of HEK-293 using 18970-1-AP

  WB result of NKCC2 antibody (18970-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NKCC2 transfected HEK-293 cells.

• 

  WB analysis using 18970-1-AP

  Boiled or non-boiled lysates of mouse kidney were subjected to SDS PAGE followed by western blot with 18970-1-AP (NKCC2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 18970-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18970-1-AP (NKCC2 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 18970-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 18970-1-AP (NKCC2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 18970-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 18970-1-AP (NKCC2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 18970-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 18970-1-AP (NKCC2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 18970-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 18970-1-AP (NKCC2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 18970-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18970-1-AP (NKCC2 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse Embryonic kidney tissue using 18970-1-AP

  IF rsult of SLC12A1 antibody (18970-1-AP, 1:900) with mouse Embryonic kidneys from E16.5 (fixed with 4% PFA at 4C for 30 min, cryosections 5% goat serum/PBST was used for blocking and antibody incubation). Red: anti-rabbit Alexa555, Blue: Hoechst.

• Featured Product
• KD/KO Validated

SLC12A1/NKCC2 Polyclonal Antibody for WB, IHC, IF, ELISA

Cat No. 18970-1-AP

Publications(32)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

NKCC2, SLC12A1, BSC1, Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2, Kidney-specific Na-K-Cl symporter

---

Tested Applications

• Positive WB detected in: HEK-293 cells, 37°C incubated mouse kidney tissue
• Positive IHC detected in: human kidney tissue, mouse kidney tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF detected in: mouse Embryonic kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000
• Immunofluorescence (IF): IF : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 7 publications below
• IF: See 22 publications below

Product Information

18970-1-AP targets SLC12A1/NKCC2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5325

  Product name: Recombinant human SLC12A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-176 aa of BC040138

  Sequence: MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQAGVVK

• Full Name: solute carrier family 12 (sodium/potassium/chloride transporters), member 1
• Calculated Molecular Weight: 121 kDa
• Observed Molecular Weight: 135 kDa
• GenBank Accession Number: BC040138
• Gene Symbol: SLC12A1/NKCC2
• Gene ID (NCBI): 6557
• RRID: AB_2877130
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13621
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Cell Stem Cell; Plasticity of distal nephron epithelia from human kidney organoids enables the induction of ureteric tip and stalk.; Authors - Sara E Howden
	IF	Nat Protoc; Generation of proximal tubule-enhanced kidney organoids from human pluripotent stem cells; Authors - Jessica M Vanslambrouck
human	IF	Nat Commun; Enhanced metanephric specification to functional proximal tubule enables toxicity screening and infectious disease modelling in kidney organoids; Authors - Jessica M. Vanslambrouck
human	IF	J Am Soc Nephrol; A Toolbox to Characterize Human Induced Pluripotent Stem Cell-Derived Kidney Cell Types and Organoids.; Authors - Jessica M Vanslambrouck
mouse	IF	J Am Soc Nephrol; Hnf4a Is Required for the Development of Cdh6-Expressing Progenitors into Proximal Tubules in the Mouse Kidney.; Authors - Sierra S Marable
mouse,human	WB,IHC	Mol Ther; Tubular-specific CDK12 knockout causes a defect in urine concentration due to premature cleavage of the slc12a1 gene.; Authors - Bin Wang