SLC12A9 Polyclonal antibody

• 

  WB analysis using 26827-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26827-1-AP (SLC12A9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26827-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26827-1-AP (SLC12A9 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

SLC12A9 Polyclonal Antibody for WB, ELISA

Cat No. 26827-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

CCC interacting protein 1, CCC6, CIP1, hCCC6, hCIP1, SLC12A9, WO3.3

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MCF-7 cells, LNCaP cells, mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26827-1-AP targets SLC12A9 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25351

  Product name: Recombinant human SLC12A9 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 417-538 aa of BC000154

  Sequence: QALLFHQVRKYLLRLDVRKDHVKFWRPQLLLLVGNPRGALPLLRLANQLKKGGLYVLGHVTLGDLDSLPSDPVQPQYGAWLSLVDRAQVKAFVDLTLSPSVRQGAQHLLRISGLESNSHPLP

• Full Name: solute carrier family 12 (potassium/chloride transporters), member 9
• Calculated Molecular Weight: 96 kDa
• Observed Molecular Weight: 101 kDa
• GenBank Accession Number: BC000154
• Gene Symbol: SLC12A9
• Gene ID (NCBI): 56996
• RRID: AB_3085908
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXP2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC12A9, also known as CCC6 and CIP1, belongs to the SLC12A transporter family. SLC12A9 encodes a 914 amino acid protein with predicted 12 TM domains, two N-glycosylation sites between TM5 and TM6, and a carboxyl terminus PKC phosphorylation site (PMID: 23506871). SLC12A9 regulates ion gradients across renal tubules and maintains cell volume (PMID: 27530302). SLC12A9 is highly expressed in placenta, brain, and kidney.