SLC13A3 Polyclonal antibody

• 

  WB analysis of mouse kidney using 26182-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 26182-1-AP (SLC13A3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 26182-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 26182-1-AP (SLC13A3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 26182-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26182-1-AP (SLC13A3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 26182-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26182-1-AP (SLC13A3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC13A3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26182-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

NADC3, Sodium-dependent high-affinity dicarboxylate transporter 2, SDCT2, NaDC-3, NaC3

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, HEK-293 cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

26182-1-AP targets SLC13A3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24183

  Product name: Recombinant human SLC13A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 568-602 aa of BC035966

  Sequence: QTIFQLGTFPDWADMYSVNVTALPPTLANDTFRTL

• Full Name: solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3
• Calculated Molecular Weight: 602 aa, 67 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC035966
• Gene Symbol: SLC13A3
• Gene ID (NCBI): 64849
• RRID: AB_2880414
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWT9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC13A3, also named NADC3 and SDCT2, belongs to the SLC13A/DASS transporter (TC 2.A.47) family and NADC subfamily. SLC13A3 encodes the plasma membrane Na+ /Dicarboxylate Cotransporter 3 (NaDC3), which imports inside the cell four to six carbon dicarboxylates as well as N-acetylaspartate (NAA). SLC13A3 is mainly expressed in kidney, but also in brain, liver, placenta and eye (PMID: 30635937). This antibody detected the 55-60 kDa band in SDS-PAGE. However, the 55 kDa (nonglycosylated) and 85 kDa (glycosylated) bands have been reported in the article (PMID: 27053689).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Mol Sci; Succinate Accumulation Is Associated with a Shift of Mitochondrial Respiratory Control and HIF-1α Upregulation in PTEN Negative Prostate Cancer Cells.; Authors - Anja Weber
human	IHC	Cell Metab; Adipocyte-derived glutathione promotes obesity-related breast cancer by regulating the SCARB2-ARF1-mTORC1 complex; Authors - Chenxi Zhao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Joo-Seop (Verified Customer) (07-23-2025)

It marks a subset of proximal tubules in the mouse kidney at P9.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: mouse kidney

SLC13A3 Antibody Immunofluorescence validation (1:100 dilution) in mouse kidney (Cat no:26182-1-AP)