SLC15A1/PEPT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC15A1/PEPT1 Polyclonal antibody, PBS Only (21726-1-PBS)

• 

  WB analysis using 21726-1-AP (same clone as 21726-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21726-1-AP (SLC15A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21726-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21726-1-AP (same clone as 21726-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21726-1-AP (SLC15A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21726-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21726-1-AP (same clone as 21726-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21726-1-AP (SLC15A1/PEPT1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21726-1-PBS in a different storage buffer formulation.

SLC15A1/PEPT1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21726-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21726-1-PBS targets SLC15A1/PEPT1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16390

  Product name: Recombinant human SLC15A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 374-580 aa of BC096327

  Sequence: VAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGPMSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVN

• Full Name: solute carrier family 15 (oligopeptide transporter), member 1
• Calculated Molecular Weight: 708 aa, 79 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC096327
• Gene Symbol: SLC15A1/PEPT1
• Gene ID (NCBI): 6564
• RRID: AB_3085668
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46059
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC15A1/PEPT1 is a peptide transporter that transports oligopeptides of 2 to 4 amino acids with a preference for dipeptides. PEPT1 mediates transepithelial transport of muramyl and N-formylated bacterial dipeptides contributing to recognition of pathogenic bacteria by the mucosal immune system. PEPT1 is primarily expressed in the small intestine (PMID: 22194420). PEPT1 is also expressed in distal colon in rodents and humans and contributes to water absorption. 71 kDa nonglycosylated PEPT1 protein can be detected (PMID: 23660505).