SLC16A13 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC16A13 Polyclonal antibody, PBS Only (30466-1-PBS)

• 

  WB analysis using 30466-1-AP (same clone as 30466-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30466-1-AP (SLC16A13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30466-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 30466-1-AP (same clone as 30466-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 30466-1-AP (SLC16A13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30466-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 30466-1-AP (same clone as 30466-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 30466-1-AP (SLC16A13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30466-1-PBS in a different storage buffer formulation.

SLC16A13 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30466-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

30466-1-PBS targets SLC16A13 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33183

  Product name: Recombinant human SLC16A13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 395-426 aa of BC142618

  Sequence: FCFSTTTSGPQDLVTEALDTKVPLPKEGLEED

• Full Name: solute carrier family 16, member 13 (monocarboxylic acid transporter 13)
• Calculated Molecular Weight: 426 aa, 45 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC142618
• Gene Symbol: SLC16A13
• Gene ID (NCBI): 201232
• RRID: AB_3086327
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7RTY0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC16A13 (solute carrier family 16 member 13), which encodes the monocarboxylate transporter 13 (MCT13), is a susceptibility gene for type 2 diabetes and is expressed in the liver and duodenum (PMID: 37630718). SLC16A13 is a potential target for the treatment of type 2 diabetes and non-alcoholic fatty liver disease (PMID: 34211098).