SLC16A4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC16A4 Polyclonal antibody, PBS Only (20889-1-PBS)

• 

  WB analysis using 20889-1-AP (same clone as 20889-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20889-1-AP (SLC16A4 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20889-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 20889-1-AP (same clone as 20889-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20889-1-AP (SLC16A4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20889-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 20889-1-AP (same clone as 20889-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 20889-1-AP (SLC16A4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20889-1-PBS in a different storage buffer formulation.

SLC16A4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20889-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

MCT 4, MCT 5, MCT4, MCT5, Monocarboxylate transporter 4

---

Product Information

20889-1-PBS targets SLC16A4 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14190

  Product name: Recombinant human SLC16A4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC021664

  Sequence: MLKREGKVQPYTKTLDGGWGWMIVIHFFLVNVFVMGMTKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLR

• Full Name: solute carrier family 16, member 4 (monocarboxylic acid transporter 5)
• Calculated Molecular Weight: 487 aa, 54 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC021664
• Gene Symbol: SLC16A4
• Gene ID (NCBI): 9122
• RRID: AB_2878757
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15374
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC16A4, also named as MCT5, is a proton-linked monocarboxylate transporter which can catalyze the rapid transport across the plasma membrane of many monocarboxylates. It has been reported that SLC16A4 is expressed in human intestine, liver and kidney. (PMID:18996437)