SLC18A1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC18A1 Polyclonal antibody, PBS Only (20340-1-PBS)

• 

  WB analysis of HEK-293 using 20340-1-AP (same clone as 20340-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20340-1-AP (SLC18A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20340-1-PBS in a different storage buffer formulation.

• 

  WB analysis of C6 using 20340-1-AP (same clone as 20340-1-PBS)

  C6 cells were subjected to SDS PAGE followed by western blot with 20340-1-AP (SLC18A1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20340-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 20340-1-AP (same clone as 20340-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 20340-1-AP (SLC18A1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20340-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 20340-1-AP (same clone as 20340-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20340-1-AP (SLC18A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20340-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 20340-1-AP (same clone as 20340-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20340-1-AP (SLC18A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20340-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 20340-1-AP (same clone as 20340-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 20340-1-AP (SLC18A1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 20340-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 20340-1-AP (same clone as 20340-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 20340-1-AP (SLC18A1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 20340-1-PBS in a different storage buffer formulation.

SLC18A1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20340-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

20340-1-PBS targets SLC18A1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14131

  Product name: Recombinant human SLC18A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-138 aa of BC009387

  Sequence: PIVPTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITR

• Full Name: solute carrier family 18 (vesicular monoamine), member 1
• Calculated Molecular Weight: 525 aa, 56 kDa
• Observed Molecular Weight: 50 kDa, 56 kDa
• GenBank Accession Number: BC009387
• Gene Symbol: SLC18A1
• Gene ID (NCBI): 6570
• RRID: AB_10666128
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54219
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.