Tested Applications
| Positive WB detected in | mouse brain tissue, HepG2 cells, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22515-1-AP targets EAAT2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18247 Product name: Recombinant human SLC1A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 460-574 aa of BC132768 Sequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK Predict reactive species |
| Full Name | solute carrier family 1 (glial high affinity glutamate transporter), member 2 |
| Calculated Molecular Weight | 574 aa, 62 kDa |
| Observed Molecular Weight | 60-70 kDa, 140 kDa |
| GenBank Accession Number | BC132768 |
| Gene Symbol | EAAT2 |
| Gene ID (NCBI) | 6506 |
| RRID | AB_2879112 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P43004 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EAAT2 (also known as GLT-1), is encoded by SLC1A2 and is a glutamate transporter which can clear the majority of extracellular glutamate in brain and prevent brain seizures.Three isoforms of EAAT2 exist due to the alternative splicing. In addition to the 65-70 kDa monomer form, 130-150 kDa dimer of EAAT2 can also be observed on SDS-PAGE. (PMID: 22114258)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for EAAT2 antibody 22515-1-AP | Download protocol |
| IP protocol for EAAT2 antibody 22515-1-AP | Download protocol |
| WB protocol for EAAT2 antibody 22515-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
EAAT2 (GLT-1) Polyclonal Antibody (Cat# 22515-1-AP) has accumulated 39 citations published in journals such as Nature Communications, Theranostics, Cell Death & Disease, Biomaterials, Neural Regeneration Research, Glia, ACS Chemical Neuroscience, and Brain Research Bulletin. The associated research fields include neuroscience, neurodegeneration (Parkinson's and Alzheimer's disease), epilepsy, depression, astrocyte biology, and glutamate transport regulation.
| Species | Application | Title |
|---|---|---|
Cyborg Bionic Syst Remote Regulation of Molecular Diffusion in Extracellular Space of Parkinson's Disease Rat Model by Subthalamic Nucleus Deep Brain Stimulation | ||
Nat Commun Major urinary protein 1 modulates neuronal excitability in the medial prefrontal cortex in a male mouse model of affective empathy. | ||
Nat Commun Astrocytic neuroligin 3 regulates social memory and synaptic plasticity through adenosine signaling in male mice | ||
J Adv Res SA supplementation during lactation promotes learning and memory by reducing H3K27me3 levels | ||
Theranostics An unrecognized mechanism of self-protection in degenerating neurons mediated by astrocytic YAP through Wnts/β-catenin/EAAT2 signaling in C9orf72-poly-GA mice | ||
Theranostics Hsp90 inhibitor HSP990 in very low dose upregulates EAAT2 and exerts potent antiepileptic activity. |
Reviews
What customers say
Both reviewers gave 5-star ratings for Western Blot applications. One user successfully detected EAAT2 in brain lysates at a 1:10,000 dilution. The other used it on human primary cortical cells at 1:1,000 dilution with overnight incubation at 4°C following SDS-PAGE. Overall, users report reliable performance for WB with clear results across different tissue and cell types.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Andrea (Verified Customer) (08-05-2026) | It works by WB on brain lysates
|
Azita (Verified Customer) (05-31-2021) | The cells were subjected to SDS PAGE followed by WB and the EAAT2 antibody was used at 1:1000 dilution and was incubated overnight in 4°C.
|
