Tested Applications
| Positive WB detected in | Raji cells, mouse brain tissue, human skeletal muscle tissue, SW480 cells, mouse kidney tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse kidney tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13067-2-AP targets SLC1A4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3763 Product name: Recombinant human SLC1A4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 431-532 aa of BC026216 Sequence: IAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKATKKGEQELAEVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVL Predict reactive species |
| Full Name | solute carrier family 1 (glutamate/neutral amino acid transporter), member 4 |
| Calculated Molecular Weight | 532 aa, 56 kDa |
| Observed Molecular Weight | 62-70 kDa |
| GenBank Accession Number | BC026216 |
| Gene Symbol | SLC1A4 |
| Gene ID (NCBI) | 6509 |
| RRID | AB_2190604 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P43007 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC1A4 antibody 13067-2-AP | Download protocol |
| IP protocol for SLC1A4 antibody 13067-2-AP | Download protocol |
| WB protocol for SLC1A4 antibody 13067-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLC1A4 (ASCT2) antibody, catalog number 13067-2-AP, has 13 citations. These appear in journals including Cell, Molecular Cancer, Advanced Science, Cell Death & Disease, Cancer Letters, British Journal of Cancer, Ecotoxicology and Environmental Safety, International Journal of Molecular Sciences, Frontiers in Oncology, Mammalian Genome, bioRxiv, and Research Square. Research fields span cancer biology (colorectal, gastric, lung, glioblastoma, prostate, HCC), serine/amino-acid metabolism, neurodegeneration (Alzheimer's), and ecotoxicology.
| Species | Application | Title |
|---|---|---|
Mol Cancer CircMYH9 drives colorectal cancer growth by regulating serine metabolism and redox homeostasis in a p53-dependent manner | ||
Adv Sci (Weinh) Skullcapflavone II Inhibits SLC1A4-Mediated L-Serine Uptake and Promotes Mitochondrial Damage in Gastric Cancer. | ||
Cell Death Dis ΔNp63α drives serine synthesis to promote carboplatin resistance in NSCLC. | ||
Cancer Lett HHLA2 promotes immune evasion in EGFR-mutant lung cancer by inhibiting CD8(+) T cell glutamine metabolism via KIR3DL3 interaction. |
Reviews
What customers say
The single review for this product reports a positive experience. The user tested it on mammary gland tumour cells by Western Blot at a 1:1000 dilution and rated it 5 stars, noting that it "works well." Overall, the feedback is favorable, with no issues or complaints mentioned.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Amy (Verified Customer) (02-06-2026) | Great, works well.
|
