SLC22A1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC22A1 Polyclonal antibody (24617-1-AP)

SLC22A1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 24617-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

Synonyms

HOCT1, OCT1, oct1_cds, Organic cation transporter 1, SLC22A1

• 

  WB analysis using 24617-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24617-1-AP (SLC22A1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 24617-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 24617-1-AP (SLC22A1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 24617-1-AP

  IP result of anti-SLC22A1 (IP:24617-1-AP, 4ug; Detection:24617-1-AP 1:1000) with mouse liver tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 24617-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 24617-1-AP (SLC22A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 24617-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 24617-1-AP (SLC22A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC22A1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24617-1-AP targets SLC22A1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18806

  Product name: Recombinant human SLC22A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 275-357 aa of BC126364

  Sequence: FLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTD

• Full Name: solute carrier family 22 (organic cation transporter), member 1
• Calculated Molecular Weight: 554 aa, 61 kDa
• Observed Molecular Weight: 61-67 kDa
• GenBank Accession Number: BC126364
• Gene Symbol: SLC22A1
• Gene ID (NCBI): 6580
• RRID: AB_2879641
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15245
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

SLC22A1 Polyclonal Antibody (Cat# 24617-1-AP) has 4 total citations. These appear in Cell Metabolism, Nature Chemical Biology, Journal of Pharmaceutical Analysis, and Journal of Food Biochemistry. The associated research fields include breast cancer metastasis and bioenergetics, cardiac cAMP signaling and contraction regulation, metabolic vulnerability in antitumor drug development, and uric acid metabolism in hyperuricemic models.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Metab; PGC-1α Promotes Breast Cancer Metastasis and Confers Bioenergetic Flexibility against Metabolic Drugs.; Authors - Sylvia Andrzejewski
		Nat Chem Biol; Cardiac contraction and relaxation are regulated by distinct subcellular cAMP pools; Authors - Ting-Yu Lin
human,mouse	WB	J Pharm Anal; Discovering metabolic vulnerability using spatially resolved metabolomics for antitumor small molecule-drug conjugates development as a precise cancer therapy strategy; Authors - Xiangyi Wang
mouse	WB	J Food Biochem; Effects of black tea and black brick tea with fungal growth on lowering uric acid levels in hyperuricemic mice.; Authors - Dongyin Yuan