SLC22A1 Polyclonal antibody

• 

  WB analysis using 24617-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24617-1-AP (SLC22A1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 24617-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 24617-1-AP (SLC22A1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 24617-1-AP

  IP result of anti-SLC22A1 (IP:24617-1-AP, 4ug; Detection:24617-1-AP 1:1000) with mouse liver tissue lysate 4000ug.

• 

  IHC staining of mouse liver using 24617-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 24617-1-AP (SLC22A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 24617-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 24617-1-AP (SLC22A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC22A1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 24617-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

Synonyms

HOCT1, OCT1, oct1_cds, Organic cation transporter 1, SLC22A1

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

24617-1-AP targets SLC22A1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18806

  Product name: Recombinant human SLC22A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 275-357 aa of BC126364

  Sequence: FLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTD

• Full Name: solute carrier family 22 (organic cation transporter), member 1
• Calculated Molecular Weight: 554 aa, 61 kDa
• Observed Molecular Weight: 61-67 kDa
• GenBank Accession Number: BC126364
• Gene Symbol: SLC22A1
• Gene ID (NCBI): 6580
• RRID: AB_2879641
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15245
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Metab; PGC-1α Promotes Breast Cancer Metastasis and Confers Bioenergetic Flexibility against Metabolic Drugs.; Authors - Sylvia Andrzejewski
mouse	WB	J Food Biochem; Effects of black tea and black brick tea with fungal growth on lowering uric acid levels in hyperuricemic mice.; Authors - Dongyin Yuan
human,mouse	WB	J Pharm Anal; Discovering metabolic vulnerability using spatially resolved metabolomics for antitumor small molecule-drug conjugates development as a precise cancer therapy strategy; Authors - Xiangyi Wang
		Nat Chem Biol; Cardiac contraction and relaxation are regulated by distinct subcellular cAMP pools; Authors - Ting-Yu Lin