SLC22A1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC22A1 Polyclonal antibody, PBS Only (24617-1-PBS)

• 

  WB analysis using 24617-1-AP (same clone as 24617-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24617-1-AP (SLC22A1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24617-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 24617-1-AP (same clone as 24617-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 24617-1-AP (SLC22A1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24617-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 24617-1-AP (same clone as 24617-1-PBS)

  IP result of anti-SLC22A1 (IP:24617-1-AP, 4ug; Detection:24617-1-AP 1:1000) with mouse liver tissue lysate 4000ug. This data was developed using the same antibody clone with 24617-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 24617-1-AP (same clone as 24617-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 24617-1-AP (SLC22A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24617-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 24617-1-AP (same clone as 24617-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 24617-1-AP (SLC22A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24617-1-PBS in a different storage buffer formulation.

SLC22A1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 24617-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

24617-1-PBS targets SLC22A1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18806

  Product name: Recombinant human SLC22A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 275-357 aa of BC126364

  Sequence: FLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTD

• Full Name: solute carrier family 22 (organic cation transporter), member 1
• Calculated Molecular Weight: 554 aa, 61 kDa
• Observed Molecular Weight: 61-67 kDa
• GenBank Accession Number: BC126364
• Gene Symbol: SLC22A1
• Gene ID (NCBI): 6580
• RRID: AB_2879641
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15245
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.