SLC22A10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC22A10 Polyclonal antibody, PBS Only (31069-1-PBS)

• 

  WB analysis using 31069-1-AP (same clone as 31069-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31069-1-AP (SLC22A10 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31069-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 31069-1-AP (same clone as 31069-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31069-1-AP (SLC22A10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31069-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 31069-1-AP (same clone as 31069-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31069-1-AP (SLC22A10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31069-1-PBS in a different storage buffer formulation.

SLC22A10 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 31069-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

31069-1-PBS targets SLC22A10 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34521

  Product name: Recombinant human SLC22A10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 281-349 aa of NM_001039752

  Sequence: ESARWLIITNKLDEGLKALRKVARTNGIKNAEETLNIEVVRSTMQEELDAAQTKTTVCDLFRNPSMRKR

• Full Name: solute carrier family 22, member 10
• Calculated Molecular Weight: 541 aa, 60 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_001039752
• Gene Symbol: SLC22A10
• Gene ID (NCBI): 387775
• RRID: AB_3669842
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q63ZE4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Organic anion transporter 5 (OAT5), also known as SLC22A10, belongs to the solute carrier group of membrane transport proteins that mediate cellular uptake of endogenous and exogenous organic ions (PMID: 20865662). Rare variants in SLC22A10 may be associated with Alzheimer's disease CSF profile of neuronal injury and inflammation (PMID: 35173266).