Home
Products
Primary Antibodies
SLC24A6 Polyclonal antibody, PBS Only (21430-1-PBS)

Filter: AllWBIHC

WB analysis using 21430-1-AP (same clone as 21430-1-PBS)
Mouse brain tissue were subjected to SDS PAGE followed by western blot with 21430-1-AP (SLC24A6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21430-1-PBS in a different storage buffer formulation.
WB analysis using 21430-1-AP (same clone as 21430-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 21430-1-AP (SLC24A6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21430-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 21430-1-AP (same clone as 21430-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21430-1-AP (SLC24A6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21430-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 21430-1-AP (same clone as 21430-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21430-1-AP (SLC24A6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21430-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 21430-1-AP (same clone as 21430-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 21430-1-AP (SLC24A6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21430-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 21430-1-AP (same clone as 21430-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 21430-1-AP (SLC24A6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21430-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 21430-1-AP (same clone as 21430-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21430-1-AP (SLC24A6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21430-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 21430-1-AP (same clone as 21430-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21430-1-AP (SLC24A6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21430-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

SLC24A6 Polyclonal antibody, PBS Only

Name: SLC24A6 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 21430-1-PBS

SLC24A6 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21430-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

21430-1-PBS targets SLC24A6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag16034 Product name: Recombinant human SLC24A6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 240-333 aa of BC098360 Sequence: YVVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKALKVFKLP Predict reactive species
Full Name	solute carrier family 24 (sodium/potassium/calcium exchanger), member 6
Calculated Molecular Weight	584 aa, 64 kDa
Observed Molecular Weight	64 kDa
GenBank Accession Number	BC098360
Gene Symbol	SLC24A6
Gene ID (NCBI)	80024
RRID	AB_10858637
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q6J4K2
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

SLC24A6, also named as NCLX, is a kind of mitochondrial sodium/calcium antiporter that mediates sodium-dependent calcium efflux from mitochondrion by mediating the exchange of 3 sodium ions per 1 calcium ion. It has been reported that SLC24A6 plays a key role in attenuating potential ROS production and injury upon cardiac reperfusion. SLC24A6 is associated with mitochondrial calcium homeostasis by mediating mitochondrial calcium extrusion. (PMID: 32728214, 20018762, 28219928)