SLC25A1 Monoclonal antibody, PBS Only

• 

  WB analysis using 66771-1-Ig (same clone as 66771-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66771-1-Ig (SLC25A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 66771-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66771-1-Ig (same clone as 66771-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66771-1-Ig (SLC25A1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66771-1-PBS in a different storage buffer formulation.

SLC25A1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66771-1-PBS

Clone No.1F11A3

Host / Isotype

Mouse / IgG3

Reactivity

Human, Mouse, Rat

Applications

WB, Indirect ELISA

Synonyms

Citrate transport protein, CTP, SLC20A3, SLC25A1, Tricarboxylate carrier protein

---

Product Information

66771-1-PBS targets SLC25A1 in WB, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG3
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7520

  Product name: Recombinant human SLC25A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-311 aa of BC004980

  Sequence: MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD

• Full Name: solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC004980
• Gene Symbol: SLC25A1
• Gene ID (NCBI): 6576
• RRID: AB_2882117
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P53007
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC25A1, also known as CIC or CTP, is a mitochondrial citrate transporter that exports citrate from the mitochondria to the cytosol. SLC25A1 is highly expressed in several tumor types. Recently it has been identified as a novel transcriptional target of mutant p53 and a negative tumor prognostic marker. In addition, defects in SLC25A1 has been found as a cause of combined D-2- and L-2-hydroxyglutaric aciduria. This antibody specifically recognized the endogenous SLC25A1; no protein was detected in cells from subjects containing two alleles with truncating mutations with this antibody. (24681808, 23561848)