SLC25A11 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC25A11 Polyclonal antibody (12253-1-AP)

• Featured Product
• KD/KO Validated

SLC25A11 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12253-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

alpha-oxoglutarate carrier, M2OM, Mitochondrial 2-oxoglutarate/malate carrier protein, OGC, OGCP

• 

  WB analysis using 12253-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12253-1-AP (SLC25A11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 12253-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12253-1-AP (SLC25A11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 12253-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12253-1-AP (SLC25A11 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 12253-1-AP

  IP result of anti-SLC25A11 (IP:12253-1-AP, 4ug; Detection:12253-1-AP 1:1000) with HEK-293 cells lysate 1560ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 12253-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 12253-1-AP (SLC25A11 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 12253-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using 12253-1-AP (SLC25A11 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC25A11 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, human kidney tissue, HEK-293 cells, Raji cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12253-1-AP targets SLC25A11 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2903

  Product name: Recombinant human SLC25A11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-314 aa of BC016294

  Sequence: MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG

• Full Name: solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11
• Calculated Molecular Weight: 314 aa, 34 kDa
• Observed Molecular Weight: 28-34 kDa
• GenBank Accession Number: BC016294
• Gene Symbol: SLC25A11
• Gene ID (NCBI): 8402
• RRID: AB_2877840
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02978
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC25A11, also known as the mitochondrial 2-oxoglutarate/malate carrier protein (OGCP), is a member of the SLC25 solute carrier family. Localized to the inner mitochondrial membrane, the protein primarily catalyzes the electroneutral exchange of 2-oxoglutarate with dicarboxylates such as malate, thereby participating in key metabolic pathways including the malate-aspartate shuttle, gluconeogenesis, and nitrogen metabolism.

Publications

What published studies show

The SLC25A11 antibody (Cat# 12253-1-AP) has 10 total citations published in journals including Science, Molecular Cell, PNAS, EMBO Reports, Cell Death & Disease, Cellular & Molecular Biology Letters, Cells, Journal of the American Heart Association, Journal of the Endocrine Society, and Redox Biology. Research fields span mitochondrial metabolism, ferroptosis, cancer (biliary tract, pancreatic, renal cell carcinoma), cardiomyopathy, pulmonary hypertension, and redox biology.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Science; Autoregulatory control of mitochondrial glutathione homeostasis; Authors - Yuyang Liu
mouse,human	WB	Mol Cell; Aspartate availability drives differential engagement of the malate-aspartate shuttle.; Authors - Julia S. Brunner ; KO Validated
human	IP,IHC,IF	Cell Mol Biol Lett; SLC25A11-mediated reprogramming of mitochondrial redox state and lipid peroxidation confers NRF2-dependent ferroptosis resistance in biliary tract cancer.; Authors - Yu-Yu Lin ; KD Validated
		Cell Death Dis; Targeting mitochondrial α-ketoglutarate sequestration disables dual oncogenic drivers and metabolic adaptability in pancreatic ductal adenocarcinoma.; Authors - Yeting Xu
mouse,human	WB,IF	Proc Natl Acad Sci U S A; Mitochondrial outer membrane protein FUNDC2 promotes ferroptosis and contributes to doxorubicin-induced cardiomyopathy; Authors - Na Ta ; KO Validated
human	WB	Cells; SLC25A11 Is Associated with KDM2A-Dependent Reduction in rRNA Transcription Induced by Aminooxyacetic Acid.; Authors - Yuji Tanaka ; KD Validated