SLC25A13 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP02610-1

  Sandwich ELISA standard curve of MP02610-1, Human SLC25A13 Recombinant Matched Antibody Pair - PBS only. 86439-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag1242. 86439-2-PBS was HRP conjugated as the detection antibody. Range: 1.56-100 ng/mL

• 

  Sample test of MP02610-1

  The mean SLC25A13 concentration was determined to be 171.52 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load.

SLC25A13 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 86439-2-PBS

Clone No.250937F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

ARALAR2, ARALAR-related gene 2, Calcium-binding mitochondrial carrier protein Aralar2, Citrin, Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial

---

Product Information

86439-2-PBS targets SLC25A13 as part of a matched antibody pair:

MP02610-1: 86439-3-PBS capture and 86439-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1242

  Product name: Recombinant human SLC25A13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 336-675 aa of BC006566

  Sequence: SVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFFGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTYELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPLFKPSVSTSKAIGGGP

• Full Name: solute carrier family 25, member 13 (citrin)
• Calculated Molecular Weight: 74 kDa
• GenBank Accession Number: BC006566
• Gene Symbol: SLC25A13
• Gene ID (NCBI): 10165
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UJS0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.