SLC25A19 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse cerebellum using 85331-1-RR (same clone as 85331-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 85331-1-RR (SLC25A19 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85331-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat cerebellum using 85331-1-RR (same clone as 85331-1-PBS)

  rat cerebellum tissue were subjected to SDS PAGE followed by western blot with 85331-1-RR (SLC25A19 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85331-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85331-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85331-1-RR against Human SLC25A19 were performed. The affinity constant is 0.307 nM.

SLC25A19 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85331-1-PBS

Clone No.242441B3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

MUP1, MTPPT, Mitochondrial thiamine pyrophosphate transporter, MCPHA, DNC

---

Product Information

85331-1-PBS targets SLC25A19 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6835

  Product name: Recombinant human SLC25A19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-320 aa of BC001075

  Sequence: MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR

• Full Name: solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC001075
• Gene Symbol: SLC25A19
• Gene ID (NCBI): 60386
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9HC21
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.