Home
Products
Primary Antibodies
SLC25A22 Polyclonal antibody, PBS Only (25402-1-PBS)

Filter: AllWBIHCIF-PIF/ICC

WB analysis using 25402-1-AP (same clone as 25402-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 25402-1-AP (SLC25A22 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25402-1-PBS in a different storage buffer formulation.
WB analysis using 25402-1-AP (same clone as 25402-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 25402-1-AP (SLC25A22 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25402-1-PBS in a different storage buffer formulation.
WB analysis using 25402-1-AP (same clone as 25402-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 25402-1-AP (SLC25A22 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25402-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 25402-1-AP (same clone as 25402-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25402-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 25402-1-AP (same clone as 25402-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25402-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 25402-1-AP (same clone as 25402-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25402-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 25402-1-AP (same clone as 25402-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25402-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 25402-1-AP (same clone as 25402-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25402-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 25402-1-AP (same clone as 25402-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25402-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 25402-1-AP (same clone as 25402-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using SLC25A22 antibody (25402-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25402-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 25402-1-AP (same clone as 25402-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 25402-1-AP (SLC25A22 antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25402-1-PBS in a different storage buffer formulation.
IF Staining of COS-7 using 25402-1-AP (same clone as 25402-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed COS-7 cells using 25402-1-AP (SLC25A22 antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25402-1-PBS in a different storage buffer formulation.

SLC25A22 Polyclonal antibody, PBS Only

Name: SLC25A22 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 25402-1-PBS

SLC25A22 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 25402-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

25402-1-PBS targets SLC25A22 in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

Tested Reactivity	human, mouse, rat, monkey
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag19958 Product name: Recombinant human SLC25A22 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 128-188 aa of BC023545 Sequence: KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK Predict reactive species
Full Name	solute carrier family 25 (mitochondrial carrier: glutamate), member 22
Calculated Molecular Weight	323 aa, 34 kDa
Observed Molecular Weight	30-34 kDa
GenBank Accession Number	BC023545
Gene Symbol	SLC25A22
Gene ID (NCBI)	79751
RRID	AB_2880060
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9H936
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

SLC25A22 encodes a mitochondrial glutamate/H+ symporter with highly expression in brain, especially in astrocytes, where it controls glutamate uptake. The mutations of SLC25A22 are associated with the early/infantile epileptic encephalopathies. It has been shown that SLC25A22 plays a key role in promoting proliferation and migration in cancer, such as human colorectal cancer (CRC) and Gallbladder cancer (GBC). And there is a result that the expression of SLC25A22 in GBC was significantly higher than that in adjacent tissues. 25402-1-AP antibody is specific to SLC25A22.(PMID: 30814911, 25033742, 24596948)