SLC25A22 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86163-1-RR (same clone as 86163-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86163-1-RR (SLC25A22 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86163-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86163-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86163-1-RR against Human SLC25A22 were performed. The affinity constant is 1.13 nM.

SLC25A22 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86163-1-PBS

Clone No.250788B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

GC 1, GC1, GC-1, Glutamate/H(+) symporter 1, NET44

---

Product Information

86163-1-PBS targets SLC25A22 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19958

  Product name: Recombinant human SLC25A22 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 128-188 aa of BC023545

  Sequence: KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK

• Full Name: solute carrier family 25 (mitochondrial carrier: glutamate), member 22
• Calculated Molecular Weight: 323 aa, 34 kDa
• Observed Molecular Weight: 30-34 kDa
• GenBank Accession Number: BC023545
• Gene Symbol: SLC25A22
• Gene ID (NCBI): 79751
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H936
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC25A22 encodes a mitochondrial glutamate/H+ symporter with highly expression in brain, especially in astrocytes, where it controls glutamate uptake. The mutations of SLC25A22 are associated with the early/infantile epileptic encephalopathies. It has been shown that SLC25A22 plays a key role in promoting proliferation and migration in cancer, such as human colorectal cancer (CRC) and Gallbladder cancer (GBC). And there is a result that the expression of SLC25A22 in GBC was significantly higher than that in adjacent tissues. 25402-1-AP antibody is specific to SLC25A22.(PMID: 30814911, 25033742, 24596948)