SLC25A23 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC25A23 Polyclonal antibody, PBS Only (20168-1-PBS)

• 

  WB analysis of mouse pancreas using 20168-1-AP (same clone as 20168-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 20168-1-AP (SLC25A23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20168-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 20168-1-AP (same clone as 20168-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 20168-1-AP (SLC25A23 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20168-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 20168-1-AP (same clone as 20168-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20168-1-AP (SLC25A23 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20168-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 20168-1-AP (same clone as 20168-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 20168-1-AP (SLC25A23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20168-1-PBS in a different storage buffer formulation.

SLC25A23 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20168-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

APC2, MCSC2, Mitochondrial adenyl nucleotide antiporter SLC25A23, Mitochondrial ATP-Mg/Pi carrier protein 2, SCaMC 3

---

Product Information

20168-1-PBS targets SLC25A23 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13987

  Product name: Recombinant human SLC25A23 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-189 aa of BC001656

  Sequence: MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTLSSAGFSAWIKDSTAEQNRSKTTVLARR

• Full Name: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23
• Calculated Molecular Weight: 468 aa, 52 kDa
• Observed Molecular Weight: 49-54 kDa
• GenBank Accession Number: BC001656
• Gene Symbol: SLC25A23
• Gene ID (NCBI): 79085
• RRID: AB_10638608
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BV35
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC25A23 gene encodes a 468 amino acids polypeptide, named SCaMC-3, with a bipartite structure typical of calcium-binding mitochondrial solute carrier (CaMSC) proteins. The amino-terminal portion harbors three canonical EF-hand calcium-binding domains while the carboxyl-terminal portion of SCaMC-3 has the characteristic features of the mitochondrial solute carrier (MSC) superfamily. Northern blot analysis reveals the presence of the transcript in brain, heart, skeletal muscle, liver and small intestine. The SLC25A23 gene undergoes alternative splicing suggesting a modular nature of the encoded product. Three out of four putative protein isoforms lack a significant portion of the third mitochondrial carrier signature. The most common SCaMC-3 isoform shows a mitochondrial subcellular localization when transfected in HeLa cells and is able to bind calcium by Ca2+ dependent mobility shift assays.(PMID: 15716113)