SLC25A25 Polyclonal antibody

• 

  WB analysis of RAW264.7 using 21568-1-AP

  RAW264.7 cells were subjected to SDS PAGE followed by western blot with 21568-1-AP (SLC25A25 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 21568-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 21568-1-AP (SLC25A25 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver using 21568-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 21568-1-AP (SLC25A25 antibody) at dilution of 1:50 (under 40x lens).

SLC25A25 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21568-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

APC3, KIAA1896, MCSC, MCSC3, PCSCL, RP11 395P17.4, SCAMC 2, SCAMC2, SLC25A25

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, RAW264.7 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

21568-1-AP targets SLC25A25 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16086

  Product name: Recombinant human SLC25A25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-53 aa of BC103933

  Sequence: MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQ

• Full Name: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25
• Calculated Molecular Weight: 469 aa, 53 kDa
• Observed Molecular Weight: 50 kDa, 100 kDa
• GenBank Accession Number: BC103933
• Gene Symbol: SLC25A25
• Gene ID (NCBI): 114789
• RRID: AB_10858638
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6KCM7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Proc Natl Acad Sci U S A; Transcriptome-wide analysis of PGC-1α-binding RNAs identifies genes linked to glucagon metabolic action.; Authors - Clint D J Tavares