SLC25A32 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC25A32 Polyclonal antibody (13080-1-AP)

• Featured Product
• KD/KO Validated

SLC25A32 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 13080-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

MFT, MFTC, Mitochondrial FAD transporter

• 

  WB analysis using 13080-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13080-1-AP (SLC25A32 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 13080-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13080-1-AP (SLC25A32 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 13080-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13080-1-AP (SLC25A32 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 13080-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using SLC25A32 antibody (13080-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 13080-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using SLC25A32 antibody (13080-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC25A32 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells, MCF-7 cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13080-1-AP targets SLC25A32 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3722

  Product name: Recombinant human SLC25A32 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-315 aa of BC021893

  Sequence: MTGQGQSASGSSAWSTVFRHVRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLTTIWKLDGLRGLYQGVTPNIWGAGLSWGLYFFFYNAIKSYKTEGRAERLEATEYLVSAAEAGAMTLCITNPLWVTKTRLMLQYDAVVNSPHRQYKGMFDTLVKIYKYEGVRGLYKGFVPGLFGTSHGALQFMAYELLKLKYNQHINRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVIDVITKTWRKEGVGGFYKGIAPNLIRVTPACCITFVVYENVSHFLLDLREKRK

• Full Name: solute carrier family 25, member 32
• Calculated Molecular Weight: 315 aa, 35 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC021893
• Gene Symbol: SLC25A32
• Gene ID (NCBI): 81034
• RRID: AB_2877913
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H2D1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Solute carrier family 25 member 32 (SLC25A32) can transfer tetrahydrofolate (THF) from cellular cytoplasm to the mitochondria as a mitochondrial folate transporter (MFT). It has been reported that SLC25A32 can also transport FAD across the mitochondrial inner membrane. Chronic alcohol exposure affects mitochondrial folate uptake and may affect the transcription of the SLC25A32. And functional SLC25A32 defect is associated with the cranial neural tube defects(PMID: 21956163; 29666258)

Publications

What published studies show

The Anti-SLC25A32 antibody (Cat# 13080-1-AP) has 1 total citation. It appears in BMC Cancer (Impact Factor: 4.1), published in 2023. The cited study investigated SLC25A32's role in promoting malignant progression of glioblastoma via activation of the PI3K-AKT signaling pathway, using WB and IHC applications in human samples. The associated research field is cancer biology, specifically glioblastoma and PI3K-AKT signaling.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	BMC Cancer; SLC25A32 promotes malignant progression of glioblastoma by activating PI3K-AKT signaling pathway; Authors - Zhiwei Xue ; KD Validated