SLC25A40 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC25A40 Polyclonal antibody, PBS Only (20615-1-PBS)

• 

  WB analysis using 20615-1-AP (same clone as 20615-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20615-1-AP (SLC25A40 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20615-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 20615-1-AP (same clone as 20615-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 20615-1-AP (SLC25A40 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20615-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 20615-1-AP (same clone as 20615-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 20615-1-AP (SLC25A40 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20615-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 20615-1-AP (same clone as 20615-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 20615-1-AP (SLC25A40 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20615-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 20615-1-AP (same clone as 20615-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 20615-1-AP (SLC25A40 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20615-1-PBS in a different storage buffer formulation.

SLC25A40 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20615-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

MCFP

---

Product Information

20615-1-PBS targets SLC25A40 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14669

  Product name: Recombinant human SLC25A40 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-110 aa of BC027322

  Sequence: MDPETRGQEIIKVTPLQQMLASCTGAILTSVIVTPLDVVKIRLQAQNNPLPKGKCFVYSNGLMDHLCVCEEGGNKLWYKKPGNFQGTLDAFFKIIRNEGIKSLWSGLPPT

• Full Name: solute carrier family 25, member 40
• Calculated Molecular Weight: 338 aa, 38 kDa
• Observed Molecular Weight: 30~38 kDa
• GenBank Accession Number: BC027322
• Gene Symbol: SLC25A40
• Gene ID (NCBI): 55972
• RRID: AB_3669338
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TBP6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC25A40 (solute carrier family 25, member 40) is one of the solute carrier (SLC) transporters that comprise a family of MCS transporters and uptakes GSH into mitochondria (PMID: 37407483). The SLC25A40 mRNA levels were significantly increased in both the kidneys of LPS mice and KMRC-1 cells after LPS treatment, when compared with those in the controls (PMID: 35955707).