SLC25A45 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC25A45 Polyclonal antibody, PBS Only (14160-1-PBS)

• 

  WB analysis of mouse skeletal muscle using 14160-1-AP (same clone as 14160-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 14160-1-AP (SLC25A45 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14160-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 14160-1-AP (same clone as 14160-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 14160-1-AP (SLC25A45 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14160-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 14160-1-AP (same clone as 14160-1-PBS)

  Immunofluorescent analysis of SH-SY5Y cells using 14160-1-AP (SLC25A45 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14160-1-PBS in a different storage buffer formulation.

SLC25A45 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 14160-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Solute carrier family 25 member 45

---

Product Information

14160-1-PBS targets SLC25A45 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5342

  Product name: Recombinant human SLC25A45 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 97-335 aa of BC041100

  Sequence: DLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQNPSSATVLVAGGLCRHCFLGGSHALRRDQVPDADGWTETQSVPGDAGLHGEQHPAGRTGSLLPGGHHQQCPRLSRQCCHLPQLRISPPLVGMSPAAMPAAPHQAHGLEASLRLEARLKACKSVQEAQPFLTKVPPTRADLGWADTCGSRKPGACAASLCSWP

• Full Name: solute carrier family 25, member 45
• Calculated Molecular Weight: 335 aa, 36 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC041100
• Gene Symbol: SLC25A45
• Gene ID (NCBI): 283130
• RRID: AB_2190339
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N413
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC25A45 (solute carrier family 25 member 45) is a mitochondrial inner membrane transporter recently identified as essential for the import of methylated amino acids. Dias et al. (2025, Molecular Cell) demonstrated that SLC25A45 specifically mediates the mitochondrial uptake of dimethylarginine and trimethyllysine, but not their unmethylated counterparts. This selective transport enables mitochondria to metabolize trimethyllysine for de novo carnitine biosynthesis, linking SLC25A45 activity to fatty acid oxidation and methylated amino acid homeostasis. A naturally occurring human variant, R285C, enhances SLC25A45 stability by disrupting m-AAA protease-dependent degradation and is associated with altered plasma levels of methylated amino acids and deoxycarnitine. Functionally, SLC25A45 defines a key metabolic node coordinating methylated amino acid turnover, carnitine synthesis, and mitochondrial signaling, implicating it in cardiovascular, renal, and metabolic pathophysiology. (PMID: 41075794)