SLC26A3 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SLC26A3 Recombinant monoclonal antibody (87216-1-RR)

• 

  WB analysis using 87216-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87216-1-RR (SLC26A3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

SLC26A3 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87216-1-RR

Clone No.252027E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Chloride anion exchanger, CLD, Down-regulated in adenoma, DRA

---

Tested Applications

• Positive WB detected in: HCT 116 cells, Caco-2 cells, COLO 205 cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87216-1-RR targets SLC26A3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34479

  Product name: Recombinant human SLC26A3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 497-764 aa of BC025671

  Sequence: LTIVFRTQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDTIKDSDEELDNNQIEVLDQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAVSFLDVSSVRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKSSIFFLTIHDAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF

• Full Name: solute carrier family 26, member 3
• Calculated Molecular Weight: 764 aa, 85 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC025671
• Gene Symbol: SLC26A3
• Gene ID (NCBI): 1811
• RRID: AB_3745411
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40879
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC26A3 (Chloride anion exchanger), also known as DRA. It is expected to be located in the cytoplasm and cell membranes. It is a transmembrane glycoprotein, which is mainly located in the lower digestive tract mucosa, especially in the apical membrane of columnar epithelium and some goblet cells. The expression level of SLC26A3 in intestine is different along different parts of intestine, and there are also differences on crypt-villus axis. It is mainly expressed in the apical membrane of colon epithelial cells, less in jejunum and ileum, but not in esophagus. It participates in the absorption of electrically neutral NaCl in intestine and works with Na+/H+ exchanger. Cl-/HCO3- exchange mediated by SLC26A3 is very important for maintaining intestinal acid-base balance. In duodenum, the physiological function of SLC26A3 is related to HCO3- secretion, which plays a central role in neutralizing gastric acid (PMID: 32989468). The molecular weight of SLC26A3 is 84 kDa.