SLC27A6 Polyclonal antibody

• 

  WB analysis using 14197-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14197-1-AP (SLC27A6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SLC27A6 Polyclonal Antibody for WB, ELISA

Cat No. 14197-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

ACSVL2, FACVL2, FATP 6, FATP6, Fatty acid transport protein 6, hVLCS H1, SLC27A6, VLCS H1, VLCSH1

---

Tested Applications

• Positive WB detected in: MCF-7 cells, mouse testis tissue, mouse liver tissue, mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

14197-1-AP targets SLC27A6 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5400

  Product name: Recombinant human SLC27A6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 280-619 aa of BC041945

  Sequence: ELGATCVLKKKFSASQFWSDCKKYDVTVFQYIGELCRYLCKQSKREGEKDHKVRLAIGNGIRSDVWREFLDRFGNIKVCELYAATESSISFMNYTGRIGAIGRTNLFYKLLSTFDLIKYDFQKDEPMRNEQGWCIHVKKGEPGLLISRVNAKNPFFGYAGPYKHTKDKLLCDVFKKGDVYLNTGDLIVQDQDNFLYFWDRTGDTFRWKGENVATTEVADVIGMLDFIQEANVYGVAISGYEGRAGMASIILKPNTSLDLEKVYEQVVTFLPAYACPRFLRIQEKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMDNLKKSYVLLTRELYDQIMLGEIKL

• Full Name: solute carrier family 27 (fatty acid transporter), member 6
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC041945
• Gene Symbol: SLC27A6
• Gene ID (NCBI): 28965
• RRID: AB_2935437
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2P4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC27A6, also known as FATP6, ACSVL2, FACVL2, belongs to the ATP-dependent AMP-binding enzyme family. SLC27A6 mediates the import of long-chain fatty acids (LCFA) into the cell by facilitating their transport at the plasma membrane (PMID: 12556534). SLC27A6 plays a pivotal role in regulating available LCFA substrates from exogenous sources in tissues undergoing high levels of beta-oxidation. SLC27A6 is strongly expressed in heart and localizes to cardiac myocytes. SLC27A6 is expressed at moderate levels in placenta, testis, and adrenal glands(PMID: 12556534).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Biochem Pharmacol; DHA Improves neurodevelopmental abnormalities in offspring of gestational diabetes mellitus patients via the PPAR-γ/FATP4 pathway; Authors - Yi Jiang