Product Information
31182-1-PBS targets SLC2A7 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34515 Product name: Recombinant human SLC2A7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 220-281 aa of NM_207420 Sequence: PESPRYSLIQKGDEATARQALRRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSLR Predict reactive species |
| Full Name | solute carrier family 2 (facilitated glucose transporter), member 7 |
| Calculated Molecular Weight | 512 aa, 56 kDa |
| GenBank Accession Number | NM_207420 |
| Gene Symbol | SLC2A7 |
| Gene ID (NCBI) | 155184 |
| RRID | AB_3669886 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q6PXP3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC2A7 (solute carrier family 2 member 7, also known as GLUT7) belongs to a family of transporters that catalyze the uptake of sugars through facilitated diffusion.

