SLC2A7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC2A7 Polyclonal antibody, PBS Only (31182-1-PBS)

• 

  IHC staining of mouse small intestine using 31182-1-AP (same clone as 31182-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 31182-1-AP (SLC2A7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31182-1-PBS in a different storage buffer formulation.

SLC2A7 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 31182-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

GLUT7, GLUT 7, Glucose transporter type 7

---

Product Information

31182-1-PBS targets SLC2A7 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34515

  Product name: Recombinant human SLC2A7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 220-281 aa of NM_207420

  Sequence: PESPRYSLIQKGDEATARQALRRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSLR

• Full Name: solute carrier family 2 (facilitated glucose transporter), member 7
• Calculated Molecular Weight: 512 aa, 56 kDa
• GenBank Accession Number: NM_207420
• Gene Symbol: SLC2A7
• Gene ID (NCBI): 155184
• RRID: AB_3669886
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6PXP3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC2A7 (solute carrier family 2 member 7, also known as GLUT7) belongs to a family of transporters that catalyze the uptake of sugars through facilitated diffusion.