SLC35A2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC35A2 Polyclonal antibody (13657-1-AP)

• Featured Product
• KD/KO Validated

SLC35A2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13657-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

SLC35A2, UDP Gal Tr, UDP galactose translocator, UDP galactose transporter, UGALT, UGAT, UGT, UGT1, UGT2, UGTL

• 

  WB analysis of HEK-293 using 13657-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13657-1-AP (SLC35A2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 13657-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13657-1-AP (SLC35A2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 13657-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13657-1-AP (SLC35A2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 13657-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13657-1-AP (SLC35A2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 13657-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13657-1-AP (SLC35A2 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 13657-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13657-1-AP (SLC35A2 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC35A2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse brain tissue
• Positive IHC detected in: human liver cancer tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13657-1-AP targets SLC35A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4524

  Product name: Recombinant human SLC35A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-242 aa of BC035747

  Sequence: MAAVGAGGSTAAPGPGAVSAGALEPGTASAAHRRLKYISLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQPSPRCSQSHSLCLCLRLRALRSPAASRAATTTAAVFPPWRPHHGALSAKVSAGEVRAGSNGGTQGRGTGVEGVGHLQDPSRHPPGPGSSGFGRWSFLPGH

• Full Name: solute carrier family 35 (UDP-galactose transporter), member A2
• Calculated Molecular Weight: 396 aa, 41 kDa
• Observed Molecular Weight: 41 kDa, 32 kDa
• GenBank Accession Number: BC035747
• Gene Symbol: SLC35A2
• Gene ID (NCBI): 7355
• RRID: AB_2877967
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P78381
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SLC35A2 Polyclonal antibody (Cat# 13657-1-AP) has a total of 5 citations. These publications appear in Frontiers in Immunology, Cell Oncology, FEBS Journal, Gene, and Aging. The associated research fields span hepatocellular carcinoma metastasis, breast cancer progression via ERK pathway activation, osteosarcoma proliferation and invasion through mitophagy regulation, colorectal cancer prognosis, and comprehensive multi-cancer immunotherapeutic analysis.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	Front Immunol; Comprehensive analysis of 33 human cancers reveals clinical implications and immunotherapeutic value of the solute carrier family 35 member A2; Authors - Shengshan Xu
human	IHC,WB	Cell Oncol (Dordr); Nucleotide sugar transporter SLC35A2 is involved in promoting hepatocellular carcinoma metastasis by regulating cellular glycosylation; Authors - Hongxia Cheng ; KD Validated
human	IHC,WB	FEBS J; SLC35A2 expression drives breast cancer progression via ERK pathway activation; Authors - Xiaochen Yang
human	WB	Gene; Solute carrier family 35 member A2 regulates mitophagy through the PI3K/AKT/mTOR axis, promoting the proliferation, migration, and invasion of osteosarcoma cells; Authors - Xiaohui Luo
human	IHC,WB	Aging (Albany NY); Comprehensive analysis of transcriptome data and experimental identification show that solute carrier 35 member A2 (SLC35A2) is a prognostic marker of colorectal cancer; Authors - Yue Wang