SLC35A2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC35A2 Polyclonal antibody, PBS Only (13657-1-PBS)

• 

  WB analysis of HEK-293 using 13657-1-AP (same clone as 13657-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13657-1-AP (SLC35A2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13657-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 13657-1-AP (same clone as 13657-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13657-1-AP (SLC35A2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13657-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 13657-1-AP (same clone as 13657-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13657-1-AP (SLC35A2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13657-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 13657-1-AP (same clone as 13657-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13657-1-AP (SLC35A2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13657-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 13657-1-AP (same clone as 13657-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13657-1-AP (SLC35A2 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 13657-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 13657-1-AP (same clone as 13657-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13657-1-AP (SLC35A2 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 13657-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SLC35A2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13657-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

13657-1-PBS targets SLC35A2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4524

  Product name: Recombinant human SLC35A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-242 aa of BC035747

  Sequence: MAAVGAGGSTAAPGPGAVSAGALEPGTASAAHRRLKYISLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQPSPRCSQSHSLCLCLRLRALRSPAASRAATTTAAVFPPWRPHHGALSAKVSAGEVRAGSNGGTQGRGTGVEGVGHLQDPSRHPPGPGSSGFGRWSFLPGH

• Full Name: solute carrier family 35 (UDP-galactose transporter), member A2
• Calculated Molecular Weight: 396 aa, 41 kDa
• Observed Molecular Weight: 41 kDa, 32 kDa
• GenBank Accession Number: BC035747
• Gene Symbol: SLC35A2
• Gene ID (NCBI): 7355
• RRID: AB_2877967
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P78381
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.