SLC35A3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC35A3 Polyclonal antibody, PBS Only (26874-1-PBS)

• 

  WB analysis using 26874-1-AP (same clone as 26874-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26874-1-AP (SLC35A3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26874-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 26874-1-AP (same clone as 26874-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 26874-1-AP (SLC35A3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26874-1-PBS in a different storage buffer formulation.

SLC35A3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26874-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

26874-1-PBS targets SLC35A3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25468

  Product name: Recombinant human SLC35A3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 158-220 aa of BC005136

  Sequence: SDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLVSFSLEPSL

• Full Name: solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3
• Calculated Molecular Weight: 325 aa, 36 kDa
• Observed Molecular Weight: 32-36 and 41 kDa
• GenBank Accession Number: BC005136
• Gene Symbol: SLC35A3
• Gene ID (NCBI): 23443
• RRID: AB_2880665
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2D2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC35A3, also named as UDP-N-acetylglucosamine transporter(NGT), is located to the Golgi apparatus. SLC35A3 can form heterologous complexes with SLC35A2(UGT) and Mgats in the Golgi membrane which may promote biosynthesis of complex N-glycans. It has been reported that the mutation of SLC35A3 is associsted with skeletal dysplasia and epilepsies which could result from impaired glycosylation of proteins. SLC35A3 has some isoforms with 32-36 kDa and 41 kDa.(PMID: 25944901, 28777481  , 16344554, 23583405)