SLC35B3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC35B3 Polyclonal antibody, PBS Only (31436-1-PBS)

• 

  WB analysis using 31436-1-AP (same clone as 31436-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31436-1-AP (SLC35B3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31436-1-PBS in a different storage buffer formulation.

SLC35B3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31436-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

PAPST2, PAPS transporter 2, CGI 19, C6orf196

---

Product Information

31436-1-PBS targets SLC35B3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34349

  Product name: Recombinant human SLC35B3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-77 aa of BC006973

  Sequence: MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNLSKFNK

• Full Name: solute carrier family 35, member B3
• Calculated Molecular Weight: 401 aa, 45 kDa
• Observed Molecular Weight: 40, 32 kDa
• GenBank Accession Number: BC006973
• Gene Symbol: SLC35B3
• Gene ID (NCBI): 51000
• RRID: AB_3742427
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9H1N7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC35B3 (solute carrier family 35 member B3) is a member of the solute carrier family. SLC35B3 is involved in transporting 3-prime phosphoadenosine 5-prime phosphosulfate (PAPS) from the nucleus or the cytosol to the Golgi lumen. The observed MW of SLC35B3 is 40 kDa and 32 kDa, which is due to alternative splicing.