SLC36A2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC36A2 Polyclonal antibody, PBS Only (21352-1-PBS)

• 

  WB analysis using 21352-1-AP (same clone as 21352-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21352-1-AP (SLC36A2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21352-1-PBS in a different storage buffer formulation.

SLC36A2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21352-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21352-1-PBS targets SLC36A2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15742

  Product name: Recombinant human SLC36A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC101101

  Sequence: MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGT

• Full Name: solute carrier family 36 (proton/amino acid symporter), member 2
• Calculated Molecular Weight: 483 aa, 53 kDa
• Observed Molecular Weight: 53-60 kDa
• GenBank Accession Number: BC101101
• Gene Symbol: SLC36A2
• Gene ID (NCBI): 153201
• RRID: AB_3085653
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q495M3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC36A2 encodes proton-coupled amino acid transporter 2 (PAT2), a high-affinity cotransporter of glycine and proline coupled with the uptake of a proton in kidney and muscles. The inactivation or reduced function of SLC36A2 is the predominant determinant of the inherited iminoglycinuria phenotype in humans.