Tested Applications
| Positive WB detected in | A549 cells, Jurkat cells, L02 cells |
| Positive IHC detected in | human kidney tissue, human liver cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20857-1-AP targets SLC38A4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14827 Product name: Recombinant human SLC38A4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-77 aa of BC101827 Sequence: MDPMELRNVNIEPDDESSSGESAPDSYIGIGNSEKAAMSSQFANEDTESQKFLTNGFLGKKKLADYADEHHPGTTSF Predict reactive species |
| Full Name | solute carrier family 38, member 4 |
| Calculated Molecular Weight | 547 aa, 61 kDa |
| Observed Molecular Weight | 61 kDa |
| GenBank Accession Number | BC101827 |
| Gene Symbol | SLC38A4 |
| Gene ID (NCBI) | 55089 |
| RRID | AB_10696186 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q969I6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC38A4 antibody 20857-1-AP | Download protocol |
| WB protocol for SLC38A4 antibody 20857-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLC38A4 antibody (Cat# 20857-1-AP) has 8 total citations. These appear in Experimental & Molecular Medicine, Journal of Clinical Investigation, Clinical & Translational Medicine, FASEB Journal, Pathology Research & Practice, Discover Oncology, bioRxiv, and Nan Fang Yi Ke Da Xue Xue Bao. The research spans tumor liver metastasis and cancer biomarkers, CFTR-regulated metabolism, prostate cancer, placental amino acid transport, fetal joint and bone development, and prenatal stress effects on offspring. Applications include WB, IF, and IHC across human, mouse, pig, and rat species.
| Species | Application | Title |
|---|---|---|
Exp Mol Med SLC38A4 promotes Kupffer cell phagocytosis and suppresses tumor liver metastasis.
| ||
J Clin Invest Arteriovenous metabolomics in pigs reveals CFTR regulation ofmetabolism inmultiple organs | ||
Clin Transl Med Melatonin inhibits lipid accumulation to repress prostate cancer progression by mediating the epigenetic modification of CES1. | ||
Pathol Res Pract Assisted reproductive technology causes reduced expression of amino acid transporters in human full-term placentas | ||
Discov Oncol SLC38A4 as a prognostic biomarker and correlated with immune infiltration in colorectal liver metastasis |
Reviews
What customers say
The single review for this antibody is highly positive, rated 5 stars. The user reported excellent performance in Western Blot on placenta tissue, noting very clean bands at a 1:1000 dilution when used with the recommended blocking buffers. Overall, the feedback highlights strong specificity and ease of use with the provided protocol.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Christopher (Verified Customer) (06-13-2024) | EXCELLENT ANTIBODY! I had very clean bands using a 1:1000 dilution with the recommended blocking buffers.
|
