Filter: AllIHC

IHC staining of mouse pancreas using 28102-1-AP (same clone as 28102-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 28102-1-AP (SLC38A5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28102-1-PBS in a different storage buffer formulation.
IHC staining of mouse pancreas using 28102-1-AP (same clone as 28102-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 28102-1-AP (SLC38A5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28102-1-PBS in a different storage buffer formulation.

SLC38A5 Polyclonal antibody, PBS Only

Name: SLC38A5 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 28102-1-PBS

SLC38A5 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 28102-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

System N transporter 2, Sodium-coupled neutral amino acid transporter 5, SNAT5, SN2, PP7194

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

28102-1-PBS targets SLC38A5 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag27881 Product name: Recombinant human SLC38A5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-48 aa of BC019246 Sequence: MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFEGKT Predict reactive species
Full Name	solute carrier family 38, member 5
Calculated Molecular Weight	472 aa, 51 kDa
Observed Molecular Weight	45 kDa
GenBank Accession Number	BC019246
Gene Symbol	SLC38A5
Gene ID (NCBI)	92745
RRID	AB_2881061
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8WUX1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™