SLC38A6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC38A6 Polyclonal antibody, PBS Only (27636-1-PBS)

• 

  WB analysis of SH-SY5Y using 27636-1-AP (same clone as 27636-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 27636-1-AP (SLC38A6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27636-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 27636-1-AP (same clone as 27636-1-PBS)

  WB result of SLC38A6 antibody (27636-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC38A6 transfected SH-SY5Y cells. This data was developed using the same antibody clone with 27636-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27636-1-AP (same clone as 27636-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27636-1-AP (SLC38A6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27636-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27636-1-AP (same clone as 27636-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27636-1-AP (SLC38A6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27636-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 27636-1-AP (same clone as 27636-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using SLC38A6 antibody (27636-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27636-1-PBS in a different storage buffer formulation.

SLC38A6 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 27636-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

Amino acid transporter SLC38A6, NAT1, NAT-1, N-system amino acid transporter 1, SNAT6

---

Product Information

27636-1-PBS targets SLC38A6 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24654

  Product name: Recombinant human SLC38A6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 142-250 aa of BC110378

  Sequence: IIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA

• Full Name: solute carrier family 38, member 6
• Calculated Molecular Weight: 456 aa, 51 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC110378
• Gene Symbol: SLC38A6
• Gene ID (NCBI): 145389
• RRID: AB_3085978
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IZM9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC38A6 is also known as SNAT6 and belongs to the amino acid/polyamine transporter 2 family. SLC38A6 is probably a sodium-dependent amino acid/proton antiporter or a neuronal transporter for glutamate. SLC38A6 has 2 isoforms with the molecular mass of 51 kDa and 58 kDa. The observed molecular weight of SLC38A6 is 43 kDa, which is consistent with the description in the literature of MW between 37 kDa and 50 kDa (PMID: 24752331).