SLC43A1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC43A1 Polyclonal antibody (10444-1-AP)

SLC43A1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10444-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, ELISA

Synonyms

LAT3, PB39, POV1, R00504, SLC43A1

• 

  WB analysis using 10444-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 10444-1-AP (SLC43A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10444-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10444-1-AP (SLC43A1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 10444-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10444-1-AP (SLC43A1 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 10444-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10444-1-AP (SLC43A1 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC43A1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: PC-3 cells, Daudi cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10444-1-AP targets SLC43A1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0305

  Product name: Recombinant human SLC43A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 107-320 aa of BC001639

  Sequence: RLVGSACFTASCTLMALASRDVEALSPLIFLALSLNGFGGICLTFTSLTLPNMFGNLRSTLMALMIGSYASSAITFPGIKLIYDAGVAFVVIMFTWSGLACLIFLNCTLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLCSPTFLWSLLTMGMTQLRIIF

• Full Name: solute carrier family 43, member 1
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 55-61 kDa
• GenBank Accession Number: BC001639
• Gene Symbol: SLC43A1
• Gene ID (NCBI): 8501
• RRID: AB_2302076
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75387
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC43A1, also named as LAT3, PB39 and POV1, belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids. It plays a role in the development of human prostate cancer, from prostatic intraepithelial neoplasia to invasive prostate cancer.

Publications

What published studies show

The SLC43A1 Polyclonal antibody (Cat# 10444-1-AP) has 3 total citations. These appear in Nature Communications, Archives of Biochemistry and Biophysics, and Nan Fang Yi Ke Da Xue Xue Bao. The cited research spans hepatocellular carcinoma metabolism, lung adenocarcinoma chemoresistance via amino acid transport barriers, and prenatal stress effects on placental amino acid transport in rats. All three studies used the antibody for Western blot.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Nat Commun; Targeting tRNA-dependent tyrosine usage unveils a metabolic vulnerability in hepatocellular carcinoma.; Authors - Hongli Zhang
human	WB	Arch Biochem Biophys; Enhancement of chemoresistance by claudin-1-mediated formation of amino acid barriers in human lung adenocarcinoma A549 cells; Authors - Riho Kimura
rat	WB	Nan Fang Yi Ke Da Xue Xue Bao; [Prenatal fear stress impairs cognitive development in offspring rats by disrupting placental amino acid transport].; Authors - DU Zhixin