SLC47A1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC47A1 Polyclonal antibody, PBS Only (20898-1-PBS)

• 

  WB analysis using 20898-1-AP (same clone as 20898-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20898-1-AP (SLC47A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20898-1-PBS in a different storage buffer formulation.

SLC47A1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20898-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

20898-1-PBS targets SLC47A1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15013

  Product name: Recombinant human SLC47A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 449-570 aa of BC010661

  Sequence: QAVCFLGFIIQLNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQLVLRRGLLLLGVFLILLVGILVRFYVRIQ

• Full Name: solute carrier family 47, member 1
• Calculated Molecular Weight: 570 aa, 62 kDa
• Observed Molecular Weight: 62 kDa, 32 and 50 kDa
• GenBank Accession Number: BC010661
• Gene Symbol: SLC47A1
• Gene ID (NCBI): 55244
• RRID: AB_2878759
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96FL8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.