SLC4A4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC4A4 Polyclonal antibody (11885-1-AP)

• Featured Product
• KD/KO Validated

SLC4A4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11885-1-AP Copied!

Publications (29)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Na(+)/HCO3(-) cotransporter, Na(+)/HCO3( ) cotransporter, kNBC1, KNBC, HNBC1

• 

  WB analysis of HEK-293 using 11885-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11885-1-AP (SLC4A4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 11885-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 11885-1-AP (SLC4A4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 11885-1-AP

  IP result of anti-SLC4A4 (IP:11885-1-AP, 4ug; Detection:11885-1-AP 1:400) with HEK-293 cells lysate 1200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 11885-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11885-1-AP (SLC4A4 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 11885-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11885-1-AP (SLC4A4 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse small intestine using 11885-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 11885-1-AP (SLC4A4 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse small intestine using 11885-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 11885-1-AP (SLC4A4 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 11885-1-AP

  Immunofluorescent analysis of HepG2 cells, using SLC4A4 antibody 11885-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC4A4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse kidney tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human kidney tissue, mouse small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11885-1-AP targets SLC4A4 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2490

  Product name: Recombinant human SLC4A4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-354 aa of BC030977

  Sequence: LRVVQPMFNHSIFTSAVSPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLP

• Full Name: solute carrier family 4, sodium bicarbonate cotransporter, member 4
• Calculated Molecular Weight: 121 kDa
• Observed Molecular Weight: 121 kDa
• GenBank Accession Number: BC030977
• Gene Symbol: SLC4A4
• Gene ID (NCBI): 8671
• RRID: AB_2191458
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6R1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Anti-SLC4A4 (NBCe1) antibody (Cat# 11885-1-AP) has 29 citations published across 17 journals, including Molecular Cell, Cell Reports, International Immunopharmacology, American Journal of Physiology–Renal Physiology, Scientific Reports, and Frontiers in Physiology. Research fields span renal physiology (ammonia metabolism, acid–base homeostasis, nephrolithiasis), ion transport (bicarbonate/sodium cotransport), oncology (HCC, lung adenocarcinoma, prostate cancer), gastrointestinal motility, and neurobiology. Applications include WB, IHC, IF, and CoIP in human, mouse, and rat models.

Automatically generated from the 29 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; The mTORC1-SLC4A7 axis stimulates bicarbonate import to enhance de novo nucleotide synthesis.; Authors - Eunus S Ali
human	WB	Cell Rep; Carbonic anhydrase 2 facilitates sorafenib resistance by counteracting MCT4-mediated intracellular pH dysregulation in HCC; Authors - Hui Lu
mouse	WB	Int Immunopharmacol; Role of declined electrogenic Na+/HCO3- cotransporter NBCe1 in mucus barrier impairment and colonic inflammation; Authors - Jing He
human	WB,IHC	Int Immunopharmacol; SLC4A4 as a novel biomarker involved in immune system response and lung adenocarcinoma progression; Authors - Siyu Quan
mouse	WB	Int J Mol Sci; Modulation of Tubular pH by Acetazolamide in a Ca2+ Transport Deficient Mice Facilitates Calcium Nephrolithiasis.; Authors - Eugenia Awuah Boadi
mouse	WB	Am J Physiol Cell Physiol; Nascent shifts in renal cellular metabolism, structure, and function due to chronic empagliflozin in prediabetic mice; Authors - Blythe D Shepard