SLC4A4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC4A4 Polyclonal antibody, PBS Only (11885-1-PBS)

• 

  WB analysis of HEK-293 using 11885-1-AP (same clone as 11885-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11885-1-AP (SLC4A4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11885-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 11885-1-AP (same clone as 11885-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 11885-1-AP (SLC4A4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11885-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 11885-1-AP (same clone as 11885-1-PBS)

  IP result of anti-SLC4A4 (IP:11885-1-AP, 4ug; Detection:11885-1-AP 1:400) with HEK-293 cells lysate 1200ug. This data was developed using the same antibody clone with 11885-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 11885-1-AP (same clone as 11885-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11885-1-AP (SLC4A4 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11885-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 11885-1-AP (same clone as 11885-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11885-1-AP (SLC4A4 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11885-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 11885-1-AP (same clone as 11885-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 11885-1-AP (SLC4A4 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11885-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 11885-1-AP (same clone as 11885-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 11885-1-AP (SLC4A4 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11885-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11885-1-AP (same clone as 11885-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using SLC4A4 antibody 11885-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 11885-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SLC4A4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 11885-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

11885-1-PBS targets SLC4A4 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2490

  Product name: Recombinant human SLC4A4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-354 aa of BC030977

  Sequence: LRVVQPMFNHSIFTSAVSPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLP

• Full Name: solute carrier family 4, sodium bicarbonate cotransporter, member 4
• Calculated Molecular Weight: 121 kDa
• Observed Molecular Weight: 121 kDa
• GenBank Accession Number: BC030977
• Gene Symbol: SLC4A4
• Gene ID (NCBI): 8671
• RRID: AB_2191458
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6R1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.