SLC52A2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC52A2 Polyclonal antibody, PBS Only (30396-1-PBS)

• 

  IHC staining of human small intestine using 30396-1-AP (same clone as 30396-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 30396-1-AP (SLC52A2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30396-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 30396-1-AP (same clone as 30396-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 30396-1-AP (SLC52A2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30396-1-PBS in a different storage buffer formulation.

SLC52A2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 30396-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

GPCR, GPCR41, GPR172A, PAR1, RFT3

---

Product Information

30396-1-PBS targets SLC52A2 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33252

  Product name: Recombinant human GPR172A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 217-276 aa of BC002917

  Sequence: LLPPPPSVPTGELGSGLQVGAPGAEEEVEESSPLQEPPSQAAGTTPGPDPKAYQLLSARS

• Full Name: Solute carrier family 52, riboflavin transporter, member 2
• Calculated Molecular Weight: 46 kDa
• GenBank Accession Number: BC002917
• Gene Symbol: SLC52A2
• Gene ID (NCBI): 79581
• RRID: AB_3742338
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAB3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC52A2 (Also known as RFVT2, RFT3) is a membrane protein that belongs to the riboflavin transporter family. SLC52A2 is a transmembrane protein that mediates cellular uptake of riboflavin. Humans are unable to synthesize vitamin B2/riboflavin and must obtain it via intestinal absorption (PubMed:20463145). Mutations in SLC52A2 have been associated with Brown-Vialetto-Van Laere syndrome 2 (BVVLS2) - an autosomal recessive progressive neurologic disorder characterized by deafness, bulbar dysfunction, and axial and limb hypotonia (PMID: 22864630, 23243084).